9:41
flagshipmerchantservices.com
Screenshot of flagshipmerchantservices.com
flagshipmerchantservices.com favicon

flagshipmerchantservices.com

17 technologies
VerifiedVisit$2M1817 Tech1 Leads
Deep Dive

Paysafe's Small Business Trojan Horse

A $2.3M revenue engine hiding behind a 1.9-star Trustpilot rating

The domain flagshipmerchantservices.com isn't a standalone brand—it's a ghost ship redirecting to Paysafe's small business vertical, masking a complex payment infrastructure play behind a confusing facade. While the front-end screams 'small business starter kit,' the backend reveals a legacy processor struggling with reputation in a hyper-competitive fintech landscape.

$2.3M
annual revenue
18
employees
1.9
trustpilot rating
13
reviews

"This isn't a brand—it's a funnel, and the water is murky."

The Invisible User Base

With zero reported monthly visits and no organic keyword footprint, flagshipmerchantservices.com operates as a silent acquisition channel rather than a destination. The 18-person team likely supports a legacy client base from pre-digital migration, where phone-based onboarding (800-978-0413) still dominates. This isn't growth—it's retention on life support.

The Trust Deficit

A 1.9-star rating from 13 reviews paints a stark picture: small businesses are actively warning others away. The gap between Paysafe's enterprise capabilities and this small-business-facing product suggests a resource allocation problem—where enterprise solutions thrive, SMBs get neglected, leading to support failures and public backlash.

The tech stack tells the story of a company caught between eras. jQuery and Bootstrap suggest legacy front-end maintenance, while Google Analytics and Tag Manager indicate modern tracking aspirations. Yet the absence of social profiles and the breadcrumb-only structured data reveal a minimal SEO investment. This isn't a digital-first business—it's a compliance-first operation wearing digital clothing.

  • No direct traffic or organic search presence—entirely reliant on referral or offline channels
  • Trustpilot score of 1.9 indicates systemic service delivery issues
  • Minimal team size (18 employees) suggests either extreme efficiency or severe understaffing
  • No funding data implies self-sustainability or stagnation
Zero digital marketing presence
Backed by Paysafe's enterprise infrastructure
Public reputation damage (1.9 stars)
Phone-based support for hands-on SMB onboarding
No visible growth trajectory
Full suite of payment tools (in-store, online, mobile)

The Ghost in the Machine

This isn't a startup to watch—it's a legacy asset being quietly managed, not grown. For founders and investors, the lesson is clear: brand equity matters, and hiding behind a parent company can't mask a damaged reputation. The real question isn't how to scale this, but why Paysafe hasn't shut it down.

What tech stack does Flagshipmerchantservices use?

25 detected
Programming Languages1
Privacy & Consent1
Advertising1
A/B Testing1
Web Standards1
UI Libraries1
JavaScript Libraries1
Tracking & Analytics8
G
Google Analytics
G
Google Tag Manager
M
Microsoft Ads (Bing)
G
Google Tag Manager
B
Bing
G
Google AdSense
G
Google Analytics
G
Google Static

How much traffic does Flagshipmerchantservices get?

Traffic & Engagement

0.0
Pages/Visit
0:00
Avg. Duration
0%
Bounce Rate
Monthly Traffic Trend+0%
0
Oct 2025
Oct
0
Nov 2025
Nov
0
Dec 2025
Dec

How is Flagshipmerchantservices's SEO?

Meta Tags

title24 chars

Paysafe | Small Business

description234 chars

Find out more about Paysafe's merchant services for small business. We offer a full suite of payment acceptance tools - in-store, online and mobile - all designed to help build and grow your business. Learn more and get started today.

languageEN-US

H1 Tags

h1Welcome to the Paysafe small business program
h1800-978-0413

Schema Types

BreadcrumbList

What is Flagshipmerchantservices's revenue?

$2M
Annual Revenue
18
6%
Employees
$126K
Revenue/Employee

Who competes with Flagshipmerchantservices?

Who works at Flagshipmerchantservices?

Loading leads...

What do customers think of Flagshipmerchantservices?

Flagship Merchant Services

Flagship Merchant Services

1.9
13 reviews
✓ Claimed

Categories

Card Processing Service#undefined

Activity & Engagement

Reply Rate
0%
Avg. Reply Time
0.0 days
Claimed Date
10/12/2020

Contact Information

Address:
30721 Russell Ranch Rd, Westlake Village, CA
Westlake Village, US

Reviews (13)

Filter by rating:
Sammy
7/25/2020
🇺🇸 United States2 reviewsOrganic
I need Merchant service

I need Merchant service, I searched and find that Flagship, was Ideal for my online business. L called on of their sales Representative, and he fill my application on the phone, and email me my application to sign it all that tacks 15 minutes. 48 hours later I was up and running, I place a real order, and get through. That is great service and perfection. Sammy Kamal Owner/President Reflective Design System LLC

The City Park Boat & RV
12/10/2025
🇺🇸 United States1 reviewsOrganicUnverified
Experience date: 12/10/2025
Find another merchant service!

Our experience with Flagship Merchant Services has been a nightmare. We utilized their processing services for only one month in 2021 and contacted them to cancel immediately thereafter. Despite this, they continued to withdraw monthly service fees—without providing any services—and these fees increased over time. Over the past four years, approximately $12,000 has been taken from our account for no services in return. We NEVER received a phone call from them about this issue. There are serious deficiencies in their billing practices. They will steal your money and do not care about customer service. You should let this ship sail.

Maksym Timofieiev
12/2/2024
🇺🇸 United States1 reviewsOrganicUnverified
Experience date: 4/9/2024
Never received my money

Never received my money ! More than 180 days . Still owes me 3000$

Nicholas Tee
9/26/2024
🇳🇿 New Zealand7 reviewsOrganicUnverified
Experience date: 9/26/2024
A HIGHLY QUESTIONABLE 'CODE OF PRACTICE'

In complete honesty if I had the choice to offer NO RED STARS, I would have preferred to. I have to say that NOBODY could EVER be so unfortunate enough to even encounter a "business" like Flagship Merchant Services AND as a result I am currently having our Lawyers prepare a case so we can walk them into a Court of Law to recover the ongoing losses and damages we have suffered over the last 5 years. While the poor people that work on their helplines cannot be faulted, it is the higher level of Management that are responsible for the way the company is operated. Disgraceful is the most appropriate description I can use. I run an online education business and have been trying escape from Flagship for over 2+ years after I discovered a number of their very questionable practices (HOWEVER they seem to keep their customers by virtually imprisoning them). 1: One - if the two of worst issues I encountered has been their overcharging. When I contacted them by phone about the matter, I was informed that "the reason we the customer, are paying so much each month" was because "Flagship do not offer or broadcast to their customers reduced prices" instead they only consider it 'AFTER the customer contacts them and asks for cheaper prices". When I questioned them about this 'policy' I was told it was our fault because"we had never asked for a reduction in prices"??!!?? SORRY, BUT THAT IS A COMPLETE JOKE. 2: If that wasn't bad enough, I have been fighting with them to change the Bank our funds were being sent to. YES ... for over TWO YEARS NOW. Each time I followed all their directions and repeatedly provided all of our new banks details, nothing happened. Finally I was put through to an individual (whose name I will not mention here because we are saving that for the Court Hearings) who messaged me from an Eastern European country, and who told me that the U.S. Bank we have been using for over 10 years "was unsatisfactory" because they were (as he described it) a 'non-self-funding Bank'. Can anyone explain exactly what a "non-self-funding Bank" is? PLEASE NOTE we had already been forced to close down our Chase Bank account, and so we have now not received a single cent from Flagship for more than 2 YEARS because they did not find our new Bank acceptable to them? " When has a Merchant Card Services Provider EVER had the right to dictate to a customer which bank they wanted them to use"? 3: While I have now not been able to access our funds for over 2 YEARS, I have been able to access our monthly Flagship monthly statements ..... and over the last 18 months WE ARE NOW PAYING OUT MORE IN FLAGSHIP MONTHLY CHARGES COSTS, than we are receiving from our paying customers. Hence the need for us now to take this into the Court Room ... and hopefully it will be a Class Action Case. ....because while Flagships people on the help Lines are great, Management of ANY FORM are impossible to contact. It is disgraceful. 4: In closing, I have to point out that we were one of many thousands of companies caught up in the recent PAYSAFE MERCHANT CARD SCANDAL where the Judge authorised a record Penalty Payment to be made of $5.4 BILLION DOLLARS ..... the largest settlement of it's kind in history. It was no surprise to discover that PaySafe on their website states .... "Flagship Merchant Services has been one of the most profitable referral programs in the merchant service industry". I would invite anyone else - or any other company - that has experienced similar problems with Flagship, to connect with me on FaceBook (Nicholas Tee - my profile shows a darkened picture of me holding a guitar). A Class Action Case is one where a prosecution can represent all victims and the Lawyers take a percentage of any recovered funds ordered by the Court. (I'm hoping that because I have used TrustPilot in a professionally appropriate and respectful manner in the past that they will approve this post)

Shannon
1/20/2024
🇺🇸 United States4 reviewsOrganicUnverified
Experience date: 1/19/2024
Cancelled my account in April but they…

Cancelled my account in April but they continue to charge me outrageous charges! I've been trying to cancel and my last charge from them is $290 in one month with no service from them! Included extra fees for NOT using their services!! They said I need to fill out cancellation paperwork but I never receive it. Don't waste your time or money. What a scam.

Frequently Asked Questions about Flagshipmerchantservices

What is Flagshipmerchantservices's Revenue?
Flagshipmerchantservices generates approximately $2M in annual revenue. With 18 employees, that's $126,000 per employee.
What does Flagshipmerchantservices do?
Find out more about Paysafe's merchant services for small business. We offer a full suite of payment acceptance tools - in-store, online and mobile - all designed to help build and grow your business. Learn more and get started today.
How fast is Flagshipmerchantservices growing?
Flagshipmerchantservices employee count has changed by 6% year over year.
What technologies does Flagshipmerchantservices use?
Flagshipmerchantservices uses 17 technologies across their website including Security, Programming Languages, Cloud & Hosting. Key technologies include HSTS, reCAPTCHA, PHP, Amazon Web Services, AWS CloudFront.
Who are Flagshipmerchantservices's competitors?
Flagshipmerchantservices's main competitors include Stratos. These companies operate in similar markets and compete for the same customer base.
What do customers think of Flagshipmerchantservices?
Flagshipmerchantservices has a Trustpilot score of 1.9 out of 5 (2 stars) based on 13 customer reviews.

Export Data

Unlock all exports

Download CSVs, JSONs & full reports

How to contact Flagshipmerchantservices?

What are Flagshipmerchantservices's key pages?

Export flagshipmerchantservices.com Data

Download the complete tech stack, analytics, leads, and company data for flagshipmerchantservices.com in JSON or CSV format. Use it for your sales pipeline, competitive analysis, or research.

Raw JSON Data

Click "Show" to view the raw API response data

About flagshipmerchantservices.com

Find out more about Paysafe's merchant services for small business. We offer a full suite of payment acceptance tools - in-store, online and mobile - all designed to help build and grow your business. Learn more and get started today.

Company Overview

flagshipmerchantservices.com
Website
finance
Industry
0
Monthly Visitors
17
Technologies
1+
Employees

flagshipmerchantservices.com Key Pages

Contact flagshipmerchantservices.com

Technology Stack

flagshipmerchantservices.com uses 17 technologies across their website including HSTS, reCAPTCHA, PHP, Amazon Web Services, AWS CloudFront, and more.

Security

HSTS, reCAPTCHA

Programming Languages

PHP

Cloud & Hosting

Amazon Web Services, AWS CloudFront

Privacy & Consent

OneTrust

Advertising

Microsoft Ads

A/B Testing

Optimizely

Traffic & Audience

0
Monthly Visits
0%
Bounce Rate
0.0
Pages/Visit
0:00
Avg. Duration

flagshipmerchantservices.com receives approximately 0 monthly visitors. The website has a bounce rate of 0% with visitors viewing an average of 0.0 pages per visit. Users spend an average of 0:00 on the site.

Frequently Asked Questions

What is flagshipmerchantservices.com?
Find out more about Paysafe's merchant services for small business. We offer a full suite of payment acceptance tools - in-store, online and mobile - all designed to help build and grow your business. Learn more and get started today.
What technologies does flagshipmerchantservices.com use?
flagshipmerchantservices.com uses 17 technologies including HSTS, reCAPTCHA, PHP, and 11 more. View the full tech stack analysis above.
How popular is flagshipmerchantservices.com?
flagshipmerchantservices.com receives approximately 0 monthly visitors.

Related Searches

flagshipmerchantservices.com pricingflagshipmerchantservices.com reviewsflagshipmerchantservices.com alternativesflagshipmerchantservices.com loginflagshipmerchantservices.com careerswhat is flagshipmerchantservices.comflagshipmerchantservices.com tech stackflagshipmerchantservices.com contactflagshipmerchantservices.com vs competitorsflagshipmerchantservices.com featureshow to use flagshipmerchantservices.comflagshipmerchantservices.com integrations

This page provides publicly available information about flagshipmerchantservices.com. Data is collected from various public sources and may not always be up to date. For the most accurate information, please visit flagshipmerchantservices.com directly at https://flagshipmerchantservices.com.